If you have been reading about BPC-157 and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Updated 2025-10-06. Numbers and descriptions here follow the published literature rather than marketing material.
BPC-157 is a synthetic peptide of fifteen amino acids, written as GEPPPGKPADDAGLV, whose sequence matches part of a larger protein identified in human gastric juice. That parent protein was described in stomach-secretion research, and the fifteen-residue fragment was named body protection compound, which gives the peptide its common label. Material used in experiments is produced by solid-phase peptide synthesis rather than extracted from tissue. The reported molecular weight is about 1419 daltons, and the chain contains several proline residues, a feature that appears in discussions of its resistance to enzymatic breakdown.
Most published findings come from rodent models, where the peptide has been examined in wound-healing, gastrointestinal-lesion, tendon, and vascular-injury preparations. A smaller number of early human studies have been reported, chiefly in inflammatory bowel conditions, but the public record is short and has not led to marketing approval in the United States or the European Union. Reviewers therefore classify the compound as investigational, and whether animal results carry over to people remains an open question rather than a settled one.
Outside laboratory supply channels, the peptide is sold as a research chemical, a category that carries no requirement to demonstrate purity, identity, or freedom from contamination. Because it is not an approved medicine, products labeled BPC-157 sit in a regulatory gap in many countries, and actual content may differ from the label. Sports organizations list it among prohibited substances, so its presence in an athlete's sample can produce a doping finding regardless of how the material was obtained.
BPC-157 is normally distributed as a lyophilised powder that ranges from white to off-white in appearance. The peptide dissolves readily in water, normal saline, and common aqueous buffers, and it is poorly soluble in nonpolar solvents such as hexane or vegetable oils. Lyophilised vials take up moisture if left open, which changes the mass of powder in the container and complicates any later weighing. Because the material is handled in small quantities, static and adhesion to glass or plastic can also cause noticeable losses during transfer.
The main chemical liabilities of this sequence are peptide-bond hydrolysis and possible aspartate-related reactions, since the peptide contains aspartic acid residues but no cysteine, methionine, or tryptophan. Absence of those three residues removes the most common oxidation and disulfide pathways from consideration. Studies of related peptides indicate that aspartate isomerisation and aspartimide formation occur most readily at Asp-Gly and Asp-Ala positions, and open questions remain about how quickly those reactions proceed under ordinary laboratory conditions. Storage guidance typically emphasises cool, dry, dark conditions to slow hydrolysis.
| Property | Value | Notes |
|---|---|---|
| Origin | Fragment of a protein found in human gastric juice | Sequence corresponds to a fifteen-residue portion of the parent protein |
| Sequence | GEPPPGKPADDAGLV | Single linear chain, fifteen amino acids |
| Reported molecular weight | About 1419 daltons | Value quoted consistently in supplier and review literature |
| Regulatory status | Not an approved human medicine in the US or EU | Handled and sold as a research chemical |
| Sports status | Listed as prohibited | Falls under non-approved-substance categories in anti-doping codes |
Most published work on BPC-157 consists of preclinical studies, including rodent models of tissue injury, gastrointestinal lesions, and vascular or tendon damage, together with in vitro cell assays. Reviews frequently note that the mechanisms proposed in these papers remain incompletely characterised and that findings have not been confirmed in large randomised human trials. The compound is widely sold as a research chemical rather than a licensed medicine, and labels commonly carry a statement that it is not for human use. Whether any of the reported animal effects translate to humans is an open question rather than an established result.
Terminology in the literature is not fully standardised. Papers and product listings use BPC-157, BPC 157, and the longer phrase stable gastric pentadecapeptide BPC 157 interchangeably, and synonyms such as bepecin or PL 14736 appear in older or company-linked publications. Purity claims and reported masses can also differ between sources because peptide preparations may include counterions, residual solvents, or bound water. This variability complicates direct comparison of results across studies and makes the exact identity and grade of a given sample worth verifying. Discussions of the compound should therefore specify the source, salt form, and stated purity where those are known.
Identity and purity are usually assessed by reversed-phase high-performance liquid chromatography with ultraviolet detection near 214 nanometers, a wavelength that captures the peptide backbone. The main peak area is reported as a percentage of total peak area, which serves as a conventional purity figure. Mass spectrometry provides an independent check on molecular mass and helps confirm the expected sequence. Additional tests may include amino acid analysis and water content determination. Results are only comparable when the same column, gradient, and detection settings are used.
Peptides are susceptible to hydrolysis, oxidation, and aggregation, and BPC-157 is no exception. The lyophilized powder form is generally more stable than a solution because residual moisture is low and molecular mobility is reduced. Once dissolved, the peptide is exposed to water, oxygen, and trace metal ions that accelerate degradation. Light exposure and repeated freeze-thaw cycles are also commonly cited as sources of loss. These general principles guide most handling recommendations found in supplier documentation.
Standard practice for the solid form is storage at minus twenty degrees Celsius or colder, kept dry and away from light. Containers are usually sealed with a desiccant to limit moisture uptake. Reconstituted solutions are typically held at two to eight degrees Celsius and used within a short window, because potency can decline over days to weeks depending on the buffer and concentration. Freezing an already dissolved sample may help, though repeated thawing is discouraged. Specific shelf-life claims vary between suppliers and are rarely supported by published stability studies.
Published work on BPC-157 spans several decades and covers a wide range of experimental models. Much of the early literature reports outcomes in animal studies involving induced injury to the gastrointestinal tract, tendons, and other tissues. The volume of preclinical reports is large, while controlled human trials remain scarce. This imbalance is a recurring point of discussion, because animal findings do not automatically translate into human effects. Reviews often note that study designs differ substantially across laboratories.
Interest in the peptide has grown through online communities that discuss self-administered use, which sits outside formal research settings. Regulatory status varies by country, and in many jurisdictions the compound is not approved as a therapeutic product. Questions about optimal routes of administration, long-term effects, and dose-response relationships remain open. Published pharmacokinetic data in humans are limited, and much of what circulates in popular discussion is extrapolated from animal work rather than measured directly in people.
=== Pregnancy === It has been found that women who consumed ≥13 mg of creatine per kg of body mass daily have a lower risk of obstetric conditions. Creatine's properties support energy for production, stabilization of maternal plasma creatine, improved pregnancy outcomes, as well as reduced oxidative stress. It was also found to reduce risk of preterm birth, support immune function, and reduce risk of perinatal brain injury. Perinatal brain injury occurs after hypoxia events, creatine allows cells to recover faster.
The following general election to the unicameral Riksdag in 1973 gave the Government the support of only 175 members, while the opposition could mobilize an equal force of 175 members. In a number of cases a tied vote ensued, and the final decision had to be determined by lot. To avoid any recurrence of this unstable situation, the number of seats in the Riksdag was reduced to 349, from 1976 onwards.
=== Galactosemia === Galactosemia results from an inability to process galactose, a simple sugar. This deficiency occurs when the gene for galactose-1-phosphate uridylyltransferase (GALT) has any number of mutations, leading to a deficiency in the amount of GALT produced. There are two forms of Galactosemia: classic and Duarte. Duarte galactosemia is generally less severe than classic galactosemia and is caused by a deficiency of galactokinase. Galactosemia renders infants unable to process the sugars in breast milk, which leads to vomiting and anorexia within days of birth. Most symptoms of the disease are caused by a buildup of galactose-1-phosphate in the body. Common symptoms include liver failure, sepsis, failure to grow, and mental impairment, among others. Buildup of a second toxic substance, galactitol, occurs in the lenses of the eyes, causing cataracts. Currently, the only available treatment is early diagnosis followed by adherence to a diet devoid of lactose, and prescription of antibiotics for infections that may develop.
Sources: en.wikipedia.org
By late 2018, Syrian opposition rebel groups were forced into Idlib Governorate, the last rebel-held governorate of Syria after seven years of fighting against the Assad regime and Syrian Army during the Syrian civil war, after the SAA captured the city of Aleppo and conducted peace deals with rebel groups in the southern Daraa Governorate. Several rebel groups were present in Idlib, including the Islamist rebel group Hay'at Tahrir al-Sham (which broke away from the Al-Nusra Front), the Turkish-backed Syrian National Army, and dozens of smaller nationalist and Islamist opposition groups which largely operate in a shared command with larger groups. In Southern Syria, the opposition consisted mostly of demobilised fighters who had undergone reconciliation through previous cease-fire agreements and subsequently conducted local insurrections as Government forces withdrew in early December. An additional American-backed Syrian Free Army opposition force controlled a section of desert around the post of al-Tanf. Between the end of the ceasefire and the start of the 2024 Syrian opposition offensives HTS leader Ahmed al-Sharaa sought peace deals with the other rebel coalitions, and hunted down Hurras al-Din and Islamic State fighters in rebel-held areas. Jolani also built institutions to digitize the rebel-held area, such as improving tax collecting, street cleaning, and food distribution, while preaching a message of unity to Syrian Christians and Shias.
=== Asia === Drugs in Asia traditionally traveled the southern routes – the main caravan axes of Southeast Asia and Southern China – and include the former opium-producing countries of Thailand, Iran, and Pakistan. After the 1990s, particularly after the end of the Cold War (1991), borders were opened and trading and customs agreements were signed so that the routes expanded to include China, Central Asia, and Russia. There are, therefore, diversified drug trafficking routes available today, particularly in the heroin trade and these thrive due to the continuous development of new markets. A large amount of drugs are smuggled into Europe from Asia. The main sources of these drugs are Afghanistan, along with countries that constituted the so-called Golden Crescent. From these producers, drugs are smuggled into the West and Central Asia to its destinations in Europe and the United States. Iran is now a common route for smugglers, having been previously a primary trading route, due to its large-scale and costly war against drug trafficking. The Border Police Chief of Iran said that his country "is a strong barrier against the trafficking of illegal drugs to Caucasus, especially the Republic of Azerbaijan." The drugs produced by the Golden Triangle of Myanmar, Laos, and Thailand, on the other hand, pass through the southern routes to feed the Australian, US, and Asian markets.
They proposed the name Parmotrema chinense, based on the assumption that Osbeck's specimen corresponded to the well-known species Parmotrema perlatum. However, this proposal was not universally adopted due to the lack of valid typification and the name's absence in the literature between 1757 and 1986.
Sishen → Port of Saldanha (OREX), for transporting iron ore and manganese Ermelo → Richards Bay Coal Terminal, for transporting coal Northern Cape manganese fields → Gqeberha / Ngqura, for transporting manganese The country's "Core Rail Network", with a combined length of 4,481km, plays a major role in connecting the country's geographically separated economic hubs (metro areas), industrial hubs, inland logistics centers, and seaports. As of 2026, the network is as follows:
Sources: en.wikipedia.org
== Damage mechanisms == Glycated hemoglobin causes an increase of highly reactive free radicals inside blood cells, altering the properties of their cell membranes. This leads to blood cell aggregation and increased blood viscosity, which results in impaired blood flow. Another way glycated hemoglobin causes damage is via inflammation, which results in atherosclerotic plaque (atheroma) formation. Free-radical build-up promotes the excitation of Fe2+-hemoglobin through Fe3+-Hb into abnormal ferryl hemoglobin (Fe4+-Hb). Fe4+ is unstable and reacts with specific amino acids in hemoglobin to regain its Fe3+ oxidation state. Hemoglobin molecules clump together via cross-linking reactions, and these hemoglobin clumps (multimers) promote cell damage and the release of Fe4+-hemoglobin into the matrix of innermost layers (subendothelium) of arteries and veins. This results in increased permeability of interior surface (endothelium) of blood vessels and production of pro-inflammatory monocyte adhesion proteins, which promote macrophage accumulation in blood vessel surfaces, ultimately leading to harmful plaques in these vessels. Highly glycated Hb-AGEs go through vascular smooth muscle layer and inactivate acetylcholine-induced endothelium-dependent relaxation, possibly through binding to nitric oxide (NO), preventing its normal function. NO is a potent vasodilator and also inhibits the formation of plaque-promoting LDLs (sometimes called "bad cholesterol") oxidized form. This overall degradation of blood cells also releases heme from them.
After tobacco is harvested, it is cured (dried), and then aged to improve its flavor. There are four common methods of curing tobacco: air curing, fire curing, flue curing, and sun curing. The curing method used depends on the type of tobacco and its intended use. Air-cured tobacco is sheltered from wind and sun in a well-ventilated barn, where it air-dries for six to eight weeks. Air-cured tobacco is low in sugar, which gives the tobacco smoke a light, sweet flavour, and high in nicotine. Cigar and burley tobaccos are air-cured. In fire curing, smoke from a low-burning fire on the barn floor permeates the leaves. This gives the leaves a distinctive smoky aroma and flavor. Fire curing takes three-to-ten weeks and produces a tobacco low in sugar and high in nicotine. Pipe tobacco, chewing tobacco, and snuff are fire-cured. Flue-cured tobacco is kept in an enclosed barn heated by flues (pipes) of hot air, but the tobacco is not directly exposed to smoke. This method produces cigarette tobacco that is high in sugar and has medium-to-high levels of nicotine. It is the fastest method of curing, requiring about a week. Virginia tobacco that has been flue-cured is also called bright tobacco, because flue curing turns its leaves gold, orange, or yellow. Sun-cured tobacco dries uncovered in the sun. This method is used in Greece, Turkey, and other Mediterranean countries to produce oriental tobacco. Sun-cured tobacco is low in sugar and nicotine and is used in cigarettes.
Corn (maize) became a staple food in the southeast United States and in parts of Europe. A disease that was characterized by dermatitis of sunlight-exposed skin was described in Spain in 1735 by Gaspar Casal. He attributed the cause to poor diet. In northern Italy it was named pellagra from the Lombard language (agra = holly-like or serum-like; pell = skin). In time, the disease was more closely linked specifically to corn. In the US, Joseph Goldberger was assigned to study pellagra by the Surgeon General of the United States. His studies confirmed a corn-based diet as the culprit, but he did not identify the root cause. Nicotinic acid was extracted from the liver by biochemist Conrad Elvehjem in 1937. He later identified the active ingredient, referring to it as "pellagra-preventing factor" and the "anti-blacktongue factor." It was also referred to as "vitamin PP", "vitamin P-P" and "PP-factor", all derived from the term "pellagra-preventive factor". In the late 1930s, studies by Tom Douglas Spies, Marion Blankenhorn, and Clark Cooper confirmed that nicotinic acid cured pellagra in humans. The prevalence of the disease was greatly reduced as a result. In 1942, when flour enrichment with nicotinic acid began, a headline in the popular press said "Tobacco in Your Bread." In response, the Council on Foods and Nutrition of the American Medical Association approved of the Food and Nutrition Board's new names niacin and niacin amide for use primarily by non-scientists.
It is a very specific tag that can be used for purification of membrane proteins. S-tag, a peptide derived from Ribonuclease A (KETAAAKFERQHMDS) SBP-tag, a peptide which binds to streptavidin (MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP) Softag 1, for mammalian expression (SLAELLNAGLGGS) Softag 3, for prokaryotic expression (TQDPSRVG) Spot-tag, a peptide recognized by a nanobody (PDRVRAVSHWSS) for immunoprecipitation, affinity purification, immunofluorescence and super resolution microscopy Strep-tag, a peptide which binds to streptavidin or the modified streptavidin called streptactin (Strep-tag II: WSHPQFEK) T7-tag, an epitope tag derived from the T7 major capsid protein of the T7 gene (MASMTGGQQMG). Used in different immunoassays as well as affinity purification Mainly used TC tag, a tetracysteine tag that is recognized by FlAsH and ReAsH biarsenical compounds (CCPGCC) Ty tag (EVHTNQDPLD) V5 tag, a peptide recognized by an antibody (GKPIPNPLLGLDST) VSV-tag, a peptide recognized by an antibody (YTDIEMNRLGK) Xpress tag (DLYDDDDK), a peptide recognized by an antibody
=== Hydraulics === Liquid is the primary component of hydraulic systems, which take advantage of Pascal's law to provide fluid power. Devices such as pumps and waterwheels have been used to change liquid motion into mechanical work since ancient times. Oils are forced through hydraulic pumps, which transmit this force to hydraulic cylinders. Hydraulics can be found in many applications, such as automotive brakes and transmissions, heavy equipment, and airplane control systems. Various hydraulic presses are used extensively in repair and manufacturing, for lifting, pressing, clamping and forming.
Sources: en.wikipedia.org
It is not approved for human use in the United States or the European Union. Clinical material has been studied in a small number of early trials, mainly for inflammatory bowel conditions, and the compound remains investigational. Regulators treat marketed products as unapproved rather than as authorized drugs.
The peptide was named after a protein fraction found in human gastric juice, and the shorter form was called body protection compound. That phrase was shortened to the abbreviation BPC. The number 157 refers to a laboratory designation used in the original isolation work.
Its sequence corresponds to a segment of a protein present in gastric secretions, but the material supplied for research is made synthetically. No commercial product is purified from human or animal tissue. The synthetic route is used because it gives a defined chain length and a reproducible sequence.
Lyophilised peptide powders are generally kept frozen or refrigerated, dry, and protected from light. Sealed vials limit moisture uptake and slow hydrolysis. Such guidance comes from general peptide chemistry rather than from stability studies specific to every product.