If you have been reading about research peptide and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Updated 2025-08-28. Numbers and descriptions here follow the published literature rather than marketing material.
Several mechanisms have been proposed to explain the activity observed in animal models. The most frequently cited involve signaling through vascular endothelial growth factor receptor 2 and modulation of the nitric oxide system. Researchers have also described interactions with protective pathways in the gut lining. These proposed mechanisms appear in the literature as hypotheses supported by preclinical observations, not as confirmed pathways in humans. The precise way the peptide produces its reported effects, and whether those effects carry across species, remain areas of active and unresolved investigation.
BPC-157 is a synthetic pentadecapeptide, meaning it consists of fifteen amino acids joined in a single chain. Its sequence is Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val, a fragment corresponding to part of a larger protein found in human gastric juice. The peptide was first described in the 1990s by researchers in Zagreb who were studying gastric protective factors. It is not a naturally circulating hormone; it is a laboratory-made fragment derived from a stomach protein. The name is an abbreviation of body protection compound, with the number referring to the fragment's position in the source protein.
Most published work on BPC-157 comes from animal experiments rather than controlled human trials. Rodent models have examined its effects on gastrointestinal lesions, tendon and ligament injury, and blood vessel formation. These studies are often small and originate from a limited number of research groups, which affects how broadly the findings can be generalized. No large randomized human trial has been reported in the peer-reviewed literature. Discussion of the compound therefore rests largely on preclinical data, and questions about its effects in people remain open rather than settled.
Identity and purity are checked with standard peptide techniques. Reversed-phase high-performance liquid chromatography separates the main peak from closely related impurities and yields a percentage purity. Mass spectrometry confirms that the measured mass matches the theoretical value. Amino acid analysis offers an independent check on overall composition. These analytical methods characterize the material itself and reveal nothing about how it behaves in a living system.
In its common research form the peptide is supplied as a lyophilized powder. It dissolves readily in water and in typical aqueous buffers, which simplifies preparation of working solutions. Laboratories usually prepare small aliquots instead of one large volume. The dry material appears as a white to off-white solid with no distinctive odor. Bulk quantities are typically shipped in sealed vials.
Lyophilized material is generally kept cold, commonly at minus twenty degrees Celsius, and shielded from moisture and light. Solutions are less stable than the dry powder, so repeated freeze-thaw cycles are avoided by splitting the material into single-use portions. Published stability data for this particular peptide are limited, which means suggested hold times should be read as provisional. Long-term refrigeration of reconstituted solutions is not well supported by available evidence.
| Property | Value | Notes |
|---|---|---|
| Molecular class | Synthetic pentadecapeptide | Composed of fifteen amino acid residues |
| Amino acid sequence | Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val | Single-letter form GEPPPGKPADDAGLV |
| Original source | Fragment of a protein in human gastric juice | First characterized in the 1990s |
| Number in name | 157 | Refers to the fragment's position in the source protein |
| Human trial evidence | Limited | Preclinical rodent data predominate |
Proposed mechanisms include interaction with the nitric oxide system, modulation of growth factor signaling, and effects on blood vessel formation. None of these has been established as the primary mode of action, and some proposed pathways rest on indirect measurements. Whether the reported effects depend on a specific receptor has not been determined. Stability in gastric acid, unusual for a peptide of this size, is also reported in animal work, but the reason for it is not firmly established.
Published studies on BPC-157 are dominated by animal models. Commonly used endpoints include healing of surgically induced lesions in the stomach, tendon-to-bone attachment after transection, and recovery from experimentally induced vascular or intestinal damage. Many of these reports come from a small number of research groups, and the peptide is often described as acting across a wide range of tissue types. That breadth is itself a point of discussion, since one molecule influencing many unrelated systems is unusual.
Human data are far more limited than animal data. A small number of clinical reports exist, generally with few participants and without the randomization or blinding expected in later-phase trials. No large, independently replicated human trial has appeared in the indexed peer-reviewed literature. Statements about effects in people therefore rest on extrapolation from animal work rather than on direct evidence, and the strength of that extrapolation remains an open question rather than a settled matter.
Most published work on BPC-157 consists of preclinical studies, including rodent models of tissue injury, gastrointestinal lesions, and vascular or tendon damage, together with in vitro cell assays. Reviews frequently note that the mechanisms proposed in these papers remain incompletely characterised and that findings have not been confirmed in large randomised human trials. The compound is widely sold as a research chemical rather than a licensed medicine, and labels commonly carry a statement that it is not for human use. Whether any of the reported animal effects translate to humans is an open question rather than an established result.
Terminology in the literature is not fully standardised. Papers and product listings use BPC-157, BPC 157, and the longer phrase stable gastric pentadecapeptide BPC 157 interchangeably, and synonyms such as bepecin or PL 14736 appear in older or company-linked publications. Purity claims and reported masses can also differ between sources because peptide preparations may include counterions, residual solvents, or bound water. This variability complicates direct comparison of results across studies and makes the exact identity and grade of a given sample worth verifying. Discussions of the compound should therefore specify the source, salt form, and stated purity where those are known.
BPC-157 is a synthetic peptide composed of fifteen amino acid residues, with the sequence Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val. Its name derives from body protection compound, a term used for a protein fraction identified in human gastric juice. Researchers in Zagreb first reported the pentadecapeptide in the early 1990s and described it as a stable fragment of that larger protein. The compound is also catalogued as PL 14736 and, in some commercial contexts, as bepecin. Its molecular formula is C62H98N16O22 and its monoisotopic mass is approximately 1419 daltons.
BPC-157 is a synthetic pentadecapeptide with the sequence GEPPPGKPADDAGLV, corresponding to a partial fragment of a larger protein detected in human gastric juice. The name derives from the parent protein designation BPC, an abbreviation of body protection compound, with 157 acting as a fraction or batch identifier used by the original investigators. Its molecular weight is approximately 1419 daltons, and the chain contains no unusual residues or disulfide bridges. In the literature it is described as a short, water-soluble fragment rather than a complete natural protein.
Most early work on this peptide originated in the 1990s from a research group in Zagreb, Croatia, relying on animal models and cell cultures. Reported observations included effects on gastrointestinal lesion healing, tendon fibroblast migration, and blood vessel formation under controlled laboratory conditions. These findings come predominantly from rodent studies and in vitro assays rather than from human trials. Controlled human data remain limited, and the degree to which animal results translate to human physiology is an open question rather than a settled fact.
BPC-157 is commonly supplied as a lyophilized powder, a freeze-dried solid that is reconstituted before use in laboratory work. As a short peptide, it dissolves readily in water and in aqueous buffer solutions, and stock solutions are typically prepared in water or a mild buffer. The chain contains several proline and acidic residues, which influence how it behaves in solution. Because the solid can take up moisture, weighing and handling are usually performed under low-humidity conditions. Its solubility class is described as freely soluble in water rather than requiring an organic solvent.
Dry powder is generally stored at low temperature, with minus twenty degrees Celsius or colder advised for extended retention. Reconstituted solutions are less stable than the solid form and are normally kept cold and shielded from repeated freeze-thaw cycles. Light exposure is avoided because some peptides degrade under ultraviolet radiation. The exact rate of degradation depends on concentration, pH, and the presence of salts, so a single shelf life does not apply to every preparation. Reported stability figures should be read as indicative of typical handling rather than as universal constants.
Confirmation of identity and purity relies on standard peptide analysis techniques. Reverse-phase high-performance liquid chromatography separates the peptide from related impurities and serves as the most common purity assay. Mass spectrometry, often coupled to that chromatography step, provides an accurate molecular mass that can be matched against the expected value. Amino acid analysis or sequencing can be added for further confirmation. Because short peptides can be produced by different synthetic routes, laboratories usually report both a chromatographic purity percentage and a mass confirmation rather than a single figure.
It is a very specific tag that can be used for purification of membrane proteins. S-tag, a peptide derived from Ribonuclease A (KETAAAKFERQHMDS) SBP-tag, a peptide which binds to streptavidin (MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP) Softag 1, for mammalian expression (SLAELLNAGLGGS) Softag 3, for prokaryotic expression (TQDPSRVG) Spot-tag, a peptide recognized by a nanobody (PDRVRAVSHWSS) for immunoprecipitation, affinity purification, immunofluorescence and super resolution microscopy Strep-tag, a peptide which binds to streptavidin or the modified streptavidin called streptactin (Strep-tag II: WSHPQFEK) T7-tag, an epitope tag derived from the T7 major capsid protein of the T7 gene (MASMTGGQQMG). Used in different immunoassays as well as affinity purification Mainly used TC tag, a tetracysteine tag that is recognized by FlAsH and ReAsH biarsenical compounds (CCPGCC) Ty tag (EVHTNQDPLD) V5 tag, a peptide recognized by an antibody (GKPIPNPLLGLDST) VSV-tag, a peptide recognized by an antibody (YTDIEMNRLGK) Xpress tag (DLYDDDDK), a peptide recognized by an antibody
== Sources == L. S. Ettre (2004) American Laboratory, May 2004, pages 4-6 In memoriam: Csaba Horváth A. Guttman (2000) American Laboratory, June 2000, pages 6-10 Archived 2022-05-20 at the Wayback Machine Happy Birthday Csaba Horváth The Hungary Page Nobel Prize Winners and Famous Hungarians: Science, Mathematics & Technology Yale news of his death at the Wayback Machine (archived June 17, 2004) "Speeches at his remembrance Service". Archived from the original on June 18, 2004. Retrieved September 13, 2007. Claudia Flavell-White The Chemical Engineer October 2010 pp 54–55 "Degrees of Separation: Chemical Engineers who Changed the World - Csaba Horváth" An Introduction to Separation Science, (1973) B.L. Karger, Cs. Horváth and L.R. Snyder, Wiley
=== Protein radical formation === Glycyl radical enzyme activating enzymes (GRE-AEs) are radical SAM subset that can house a stable and catalytically essential glycyl radical in their active state. The underlying chemistry is considered to be the simplest in the radical SAM superfamily with H-atom abstraction by the 5'-dAdo radical being the product of the reaction. A few examples include:
Higher pressure than CCC (typical operation pressures of 40–160 bar vs 5–25 bar) As the pressure drops on the LiLiChro's rotor with the new cells is less than 10bar, this disadvantage has been overcome by the technology and the all-new rotary union seals will last for years of continuous use. Rotary seal wear over time
==== Ethyl alcohol absorption ==== Relatively new research involves the encapsulation of digestive enzymes within a non-toxic polymer shell. The enzyme filled nanoshell has been proven in lab mice to absorb ethyl alcohol from the bloodstream, therefore resulting in reduced blood alcohol levels. It has been concluded that the particles act as organelles, which proposes other benefits to enzyme therapies. This discovery is introducing other studies, such as encapsulation methods for hair loss.
Sources: en.wikipedia.org
=== Transgender hormone therapy === Dutasteride is sometimes used as a component of hormone therapy for transgender women in combination with an estrogen and/or another antiandrogen such as spironolactone. It may be useful for preventing and treating scalp hair loss and can also be used as a general antiandrogen for those who have issues tolerating spironolactone, though as a α-reductase inhibitor it has limited effects compared to AR antagonists.
== Further reading == "Ion Exchange Chemistry and Operation". Remco Engineering. Archived from the original on 2014-02-20. Retrieved 2014-05-16. Friedrich G. Helfferich (1962). Ion Exchange. Courier Dover Publications. ISBN 978-0-486-68784-1. {{cite book}}: ISBN / Date incompatibility (help) Ion Exchangers (K. Dorfner, ed.), Walter de Gruyter, Berlin, 1991. C. E. Harland, Ion exchange: Theory and Practice, The Royal Society of Chemistry, Cambridge, 1994. Ion exchange (D. Muraviev, V. Gorshkov, A. Warshawsky), M. Dekker, New York, 2000. A. A. Zagorodni, Ion Exchange Materials: Properties and Applications, Elsevier, Amsterdam, 2006. Alexandratos S D . Ion-Exchange Resins: A Retrospective from Industrial and Engineering Chemistry Research. Industrial & Engineering Chemistry Research, 2009. Catalyst system comprising an ion exchange resin and a dimethyl thiazolidine promoter, Hasyagar U K, Mahalingam R J, Kishan G, WO 2012.
Maintaining a healthy weight – Proper nutrition – Regular physical exercise – in addition to helping to maintain a healthy weight, sufficient vigorous physical exercise increases cells' sensitivity to insulin, and can thus prevent and possibly revert insulin resistance. Medication – specific medications have been shown to be able to prevent type 2 diabetes. However, the disease can often be delayed through proper nutrition and regular exercise.
PET scanning with the radiotracer [18F]fluorodeoxyglucose (FDG) is widely used in clinical oncology. FDG is a glucose analog that is taken up by glucose-using cells and phosphorylated by hexokinase (whose mitochondrial form is significantly elevated in cancer). Metabolic trapping of the radioactive glucose molecule allows the PET scan to be utilized. The concentrations of imaged FDG tracer indicate tissue metabolic activity as it corresponds to the regional glucose uptake. FDG is used to explore the possibility of cancer spreading to other body sites (cancer metastasis). These FDG PET scans for detecting cancer metastasis are the most common in standard medical care (representing 90% of current scans). The same tracer may also be used for the diagnosis of types of dementia. Less often, other radioactive tracers, usually but not always labelled with fluorine-18 (18F), are used to image the tissue concentration of different kinds of molecules of interest inside the body. Because the hydroxy group that is replaced by fluorine-18 to generate FDG is required for the next step in glucose metabolism in all cells, no further reactions occur in FDG. Furthermore, most tissues (with the notable exception of liver and kidneys) cannot remove the phosphate added by hexokinase. This means that FDG will remain trapped in any cell that takes it up until it decays, since phosphorylated sugars, due to their ionic charge, cannot exit from the cell.
=== Medications === The antifibrotics pirfenidone and nintedanib have been shown to slow the decline in lung function (as measured by forced vital capacity [FVC]) in those with ILD compared to placebo. Pirfenidone was associated with a 45% less decline in FVC at 52 weeks compared to placebo in a trial involving people with idiopathic pulmonary fibrosis, and was associated with a slower FVC decline in those with progressive pulmonary fibrosis. Nintedanib was also associated with a slower FVC decline and increased mean survival in people with ILD. The immunomodulator tocilizumab has a benefit in scleroderma associated ILD by helping to preserve lung function (as measured by FVC) at 48 weeks. The immunomodulators cyclophosphamide, mycophenolate mofetil and rituximab all showed improved lung function (as measured by % predicted FVC) compared to placebo in systemic sclerosis or scleroderma associated ILD. The inhaled vasodilator treprostinil (a synthetic prostacyclin which acts as a prostaglandin I2 analogue) is indicated in the treatment of pulmonary hypertension secondary to interstitial lung disease and is associated with improved exercise capacity as measured by a 6-minute walk test.
Sources: en.wikipedia.org
It is a chain of fifteen amino acids, referred to as a pentadecapeptide. The sequence is Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val. It corresponds to a fragment of a protein found in human gastric juice.
It is neither a naturally circulating hormone nor an approved medicine in most countries. It is a synthetic peptide fragment used chiefly as a laboratory research material. Its regulatory status varies by jurisdiction, and it is not authorized as a therapeutic product in the United States or the European Union.
Published human evidence is very limited. Most findings come from rodent studies conducted by a small number of groups. As a result, statements about its effects in humans are generally described as uncertain rather than established.
Dry powder is commonly held at minus twenty degrees Celsius, desiccated and away from light. Cold storage slows degradation of the lyophilized material.