gastric juice protein is one of those subjects where the details matter more than the headlines. This page pulls together the background, the mechanisms, and the practical points readers ask about most.
Last reviewed on 2025-11-22. Where a claim depends on a specific study, the study is described rather than over-claimed.
Identity and purity are usually assessed with reversed-phase high-performance liquid chromatography, often paired with mass spectrometry using electrospray or MALDI ionisation. Amino acid analysis and peptide mapping by enzymatic digestion provide additional sequence-level confirmation. Purity is commonly reported as an area percentage from a chromatographic trace, and water content can be measured by Karl Fischer titration. Reported masses may differ by tens of daltons between sources because preparations can contain acetate or trifluoroacetate counterions, and such differences are not by themselves evidence of a different peptide.
BPC-157 is normally distributed as a lyophilised powder that ranges from white to off-white in appearance. The peptide dissolves readily in water, normal saline, and common aqueous buffers, and it is poorly soluble in nonpolar solvents such as hexane or vegetable oils. Lyophilised vials take up moisture if left open, which changes the mass of powder in the container and complicates any later weighing. Because the material is handled in small quantities, static and adhesion to glass or plastic can also cause noticeable losses during transfer.
Terminology in the literature is not fully standardised. Papers and product listings use BPC-157, BPC 157, and the longer phrase stable gastric pentadecapeptide BPC 157 interchangeably, and synonyms such as bepecin or PL 14736 appear in older or company-linked publications. Purity claims and reported masses can also differ between sources because peptide preparations may include counterions, residual solvents, or bound water. This variability complicates direct comparison of results across studies and makes the exact identity and grade of a given sample worth verifying. Discussions of the compound should therefore specify the source, salt form, and stated purity where those are known.
BPC-157 is a synthetic peptide composed of fifteen amino acid residues, with the sequence Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val. Its name derives from body protection compound, a term used for a protein fraction identified in human gastric juice. Researchers in Zagreb first reported the pentadecapeptide in the early 1990s and described it as a stable fragment of that larger protein. The compound is also catalogued as PL 14736 and, in some commercial contexts, as bepecin. Its molecular formula is C62H98N16O22 and its monoisotopic mass is approximately 1419 daltons.
Most published work on BPC-157 consists of preclinical studies, including rodent models of tissue injury, gastrointestinal lesions, and vascular or tendon damage, together with in vitro cell assays. Reviews frequently note that the mechanisms proposed in these papers remain incompletely characterised and that findings have not been confirmed in large randomised human trials. The compound is widely sold as a research chemical rather than a licensed medicine, and labels commonly carry a statement that it is not for human use. Whether any of the reported animal effects translate to humans is an open question rather than an established result.
| Property | Value | Notes |
|---|---|---|
| Appearance | White to off-white powder | Lyophilised material; shade varies slightly between lots |
| Solubility in water | Freely soluble | Dissolves in water, saline, and aqueous buffers |
| Solubility in nonpolar solvents | Poorly soluble | Not compatible with oils or hydrocarbon solvents |
| Typical storage temperature | About −20 °C | Lyophilised, dry, dark storage slows hydrolysis |
| Common purity method | Reversed-phase HPLC | Area percentage, usually paired with mass spectrometry |
Standard practice for the solid form is storage at minus twenty degrees Celsius or colder, kept dry and away from light. Containers are usually sealed with a desiccant to limit moisture uptake. Reconstituted solutions are typically held at two to eight degrees Celsius and used within a short window, because potency can decline over days to weeks depending on the buffer and concentration. Freezing an already dissolved sample may help, though repeated thawing is discouraged. Specific shelf-life claims vary between suppliers and are rarely supported by published stability studies.
Identity and purity are usually assessed by reversed-phase high-performance liquid chromatography with ultraviolet detection near 214 nanometers, a wavelength that captures the peptide backbone. The main peak area is reported as a percentage of total peak area, which serves as a conventional purity figure. Mass spectrometry provides an independent check on molecular mass and helps confirm the expected sequence. Additional tests may include amino acid analysis and water content determination. Results are only comparable when the same column, gradient, and detection settings are used.
Peptides are susceptible to hydrolysis, oxidation, and aggregation, and BPC-157 is no exception. The lyophilized powder form is generally more stable than a solution because residual moisture is low and molecular mobility is reduced. Once dissolved, the peptide is exposed to water, oxygen, and trace metal ions that accelerate degradation. Light exposure and repeated freeze-thaw cycles are also commonly cited as sources of loss. These general principles guide most handling recommendations found in supplier documentation.
Interest in the peptide has grown through online communities that discuss self-administered use, which sits outside formal research settings. Regulatory status varies by country, and in many jurisdictions the compound is not approved as a therapeutic product. Questions about optimal routes of administration, long-term effects, and dose-response relationships remain open. Published pharmacokinetic data in humans are limited, and much of what circulates in popular discussion is extrapolated from animal work rather than measured directly in people.
BPC-157 is a synthetic peptide built from fifteen amino acids, referred to in the literature as a pentadecapeptide. Its sequence was derived from a larger protein found in human gastric juice, commonly called body protection compound. Researchers first described the fragment in the early 1990s and named it after the parent protein plus a numeric identifier. The peptide does not correspond to a single marketed medicine; it is primarily a laboratory research material. Suppliers distribute it as a lyophilized powder intended for experimental use.
Purity is ordinarily reported as a percentage from reverse-phase high-performance liquid chromatography, where the area of the main peak is compared with the total peak area. Identity is confirmed by mass spectrometry, since the measured mass can be checked against the value calculated from the sequence. Some certificates also include amino acid analysis or sequence confirmation by tandem mass spectrometry. A single purity number does not describe the profile of related impurities, so the underlying chromatogram and spectrum usually carry more information than the headline figure.
Material of this kind is sold for laboratory research, and labels typically state that it is not intended for human or veterinary use. In many countries it is not an approved medicine, and sports antidoping rules place it among prohibited non-approved substances. Buyers commonly review a certificate of analysis, an independent test report, and the declared storage conditions. Batch-to-batch variation in purity and in counterion content is possible, and how much that variation affects experimental outcomes remains an open question.
=== The 2010s === For its 2010 and 2012 summer tours, the band was once again paired with Chicago, as it had been in 1974, 1999, and 2008. In 2010, Skylark resigned from the band after suffering a stroke. John Cowan, who had originally toured with the band in the mid-1990s, returned to take Skylark's place, and has been with the band ever since. Three months later, before the band embarked on its 2010 summer tour with Chicago, Hossack was forced to sit out following a diagnosis of cancer. Tony Pia, a member of the Brian Setzer Orchestra, was recruited to substitute for Hossack. Pia became an official touring member of the band following Hossack's death in 2012. The Doobie Brothers released their 13th studio album, World Gone Crazy, helmed by their longtime producer Ted Templeman, in 2010. World Gone Crazy was the first Doobie Brothers album Templeman produced since One Step Closer in 1980. The album's first single, "Nobody", was free-streamed on their website. By 2012, five members of the Doobie Brothers family were deceased: percussionist/vocalist LaKind in 1992, original bass guitarist / vocalist Shogren in 1999; saxophonist, keyboardist, vocalist, and flutist Bumpus in 2004, while en route to California for a solo tour; drummer and vocalist Knudsen in 2005, and drummer Hossack in 2012. The official documentary, Let the Music Play: The Story of the Doobie Brothers, was released in 2012. It features interviews and rare footage from their early days of the 1970s to the present day.
Quantum dots (QDs) or semiconductor nanocrystals are semiconductor particles a few nanometres in size with optical and electronic properties that differ from those of larger particles via quantum mechanical effects. They are a central topic in nanotechnology and materials science. When a quantum dot is illuminated by UV light, an electron in the quantum dot can be excited to a state of higher energy. In the case of a semiconducting quantum dot, this process corresponds to the transition of an electron from the valence band to the conduction band. The excited electron can drop back into the valence band releasing its energy as light. This light emission (photoluminescence) is illustrated in the figure on the right. The color of that light depends on the energy difference between the discrete energy levels of the quantum dot in the conduction band and the valence band. In other words, a quantum dot can be defined as a structure on a semiconductor which is capable of confining electrons in three dimensions, enabling the ability to define discrete energy levels. The quantum dots are tiny crystals that can behave as individual atoms, and their properties can be manipulated. Nanoscale materials with semiconductor properties tightly confine either electrons or electron holes. The confinement is similar to a three-dimensional particle in a box model. The quantum dot absorption and emission features correspond to transitions between discrete quantum mechanically allowed energy levels in the box that are reminiscent of atomic spectra.
== See also == Family tree of German monarchs – he was related to every other ruler of Germany List of coupled cousins Austro-Hungarian entry into World War I Franc Jozeph Island, island in Albania named in honor of the Emperor. Order of St. George (Habsburg-Lorraine) Franz Josef Glacier was named after Emperor Franz Joseph I by the German geologist Julius von Haast in 1865.
Media related to Bananas and plantains as food at Wikimedia Commons Musapedia: "The banana knowledge compendium", maintained by ProMusa CGIAR's RTB Research Program Banana Page Banana and Plantain at the International Institute of Tropical Agriculture (IITA)
Melamine is an organic compound with the formula C3H6N6. This white solid is a trimer of cyanamide, with a 1,3,5-triazine skeleton. Like cyanamide, it contains 66% nitrogen by mass, and its derivatives have fire-retardant properties due to its release of nitrogen gas when burned or charred. Melamine can be combined with formaldehyde and other agents to produce melamine resins. Such resins are characteristically durable thermosetting plastic used in high-pressure decorative laminates such as Formica, melamine dinnerware including cooking utensils, plates, and plastic products, laminate flooring, and dry erase boards. Melamine foam is used as insulation and soundproofing material, and in polymeric cleaning products such as Magic Eraser. Melamine gained infamy when Chinese food producers Sanlu Group added it to baby formula in order to increase the apparent protein content, causing the 2008 Chinese milk scandal. Ingestion of melamine may lead to reproductive damage, or bladder or kidney stones, and bladder cancer. It is also an irritant when inhaled or in contact with the skin or eyes. The United Nations' food standards body, the Codex Alimentarius Commission, has set the maximum amount of melamine allowed in powdered infant formula to 1 mg/kg and the amount of the chemical allowed in other foods and animal feed to 2.5 mg/kg. While not legally binding, the levels allow countries to ban importation of products with excessive levels of melamine.
Sources: en.wikipedia.org
== Synthesis == ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
== Best Practices for Hit Finding == For educational purposes the European Federation for Medicinal Chemistry and Chemical Biology (EFMC) shared a series of webinars including 'Best Practices for Hit Finding' as well as 'Hit Generation Case Studies'.
=== Use of nuclear properties === A technique similar to radioisotopic labeling is radiometric dating: using the known half-life of an unstable element, one can calculate the amount of time that has elapsed since a known concentration of isotope existed. The most widely known example is radiocarbon dating used to determine the age of carbonaceous materials. Several forms of spectroscopy rely on the unique nuclear properties of specific isotopes, both radioactive and stable. For example, nuclear magnetic resonance (NMR) spectroscopy can be used only for isotopes with a nonzero nuclear spin. The most common nuclides used with NMR spectroscopy are 1H, 2D, 15N, 13C, and 31P. Mössbauer spectroscopy also relies on the nuclear transitions of specific isotopes, such as 57Fe. Radionuclides also have important uses. Nuclear power and nuclear weapons development require relatively large quantities of specific isotopes. Nuclear medicine and radiation oncology utilize radioisotopes respectively for medical diagnosis and treatment.
=== Supply Chain & Freight === Supply Chain & Freight (UPS-SCS for UPS Supply Chain Solutions) includes UPS' forwarding and contract logistics operations and other related business units. UPS' forwarding and logistics business provides services in more than 175 countries and territories worldwide and includes worldwide supply chain design, execution and management, freight forwarding and distribution, customs brokerage, mail and consulting services. Other business units within this segment include The UPS Store and UPS Capital.
Sources: en.wikipedia.org
Lyophilised peptide powders are generally kept frozen or refrigerated, dry, and protected from light. Sealed vials limit moisture uptake and slow hydrolysis. Such guidance comes from general peptide chemistry rather than from stability studies specific to every product.
Reversed-phase HPLC is the standard approach, with purity expressed as a percentage of total peak area. Mass spectrometry confirms the expected molecular mass and can reveal adducts or truncated sequences. Neither method on its own establishes biological activity.
Small mass differences often reflect different counterions, such as acetate versus trifluoroacetate, or bound water rather than a different amino acid sequence. Mass spectrometry can distinguish these forms when the ionisation conditions are known. Exact sequence confirmation requires peptide mapping or tandem mass spectrometry.
BPC-157 is a synthetic fifteen-amino-acid peptide whose sequence corresponds to a fragment of a protein found in human gastric juice. It is studied mainly in preclinical research and is not an approved pharmaceutical product in major markets. Materials sold for laboratory use are typically labelled as research chemicals.